Compound records · updated 27 Aug 2026

Mazdutide (IBI362)

Mazdutide is a 34-residue lipidated peptide built on an oxyntomodulin backbone that engages both the GLP-1 and the glucagon receptors. China approved it in June 2025; it holds no marketing authorisation anywhere else. Four phase 3 trials have been published, all conducted in Chinese adults. Two randomised trials in non-Chinese populations have been reported — a published 32-participant phase 1 in the United States, and a 179-participant phase 2 that exists only as a ClinicalTrials.gov results posting with no journal article attached to it.

Strongest evidence: Human dataRandomised phase 3 trials in humans; approved in China only. No FDA record was returned by Drugs@FDA; no European authorisation was located, and the EMA register could not be queried directly. 20 claims logged 12 with primary citations 8 traced to no source
Identity data
Class
Lipidated synthetic peptide; oxyntomodulin analogue and dual agonist at the GLP-1 and glucagon receptors
CAS number
2259884-03-0
PubChem CID
167312357 — resolves from the names mazdutide, IBI362 and LY3305677 and carries the correct CAS, but the deposited structure omits one of the four serines in the GSRS subunit; the formula and mass on that record are for a 33-residue deposit
Molecular formula
C210H322N46O67 (composed from the GSRS-registered structure; PubChem CID 167312357 deposits C207H317N45O65 for a serine-deficient structure, and the GSRS molecular formula property reads C210H328O69N46 — see the unsourced entry recording the disagreement)
Molecular weight
≈4563 g/mol (4563.14, average masses, computed from the GSRS-registered structure; PubChem gives ≈4476 for its deposit and GSRS carries a calculated MOL_WEIGHT property of 3790)
Sequence
34 residues: His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Lys-Lys-Ala-Lys-Glu-Phe-Val-Glu-Trp-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly, C-terminal glycinamide, with 2-aminoisobutyric acid at position 2 and the Lys20 side chain acylated by a C20 diacid through a gamma-glutamyl spacer and two AEEA linkers
Also indexed as
IBI362, IBI-362, LY3305677, LY-3305677, GTPL13924; UNII MB76Z4IBZ5; INN 12034; USAN JK-37; NCI Thesaurus C186406

Identity and regulatory status

One structure is registered for mazdutide, and three different molecular formulae are attached to it. The FDA Global Substance Registration System holds the registration under UNII MB76Z4IBZ5, with CAS number 2259884-03-0, INN 12034 and USAN code JK-37, and describes a single 34-residue chain, HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG, carrying 2-aminoisobutyric acid at position 2, a C-terminal glycinamide, and an acyl group on the lysine at position 20 built from a twenty-carbon diacid attached through a gamma-glutamyl spacer and two AEEA linkers. Composing that structure gives C210H322N46O67 and an average mass of 4563.14 g/mol. PubChem's entry does not match it: CID 167312357 reads C207H317N45O65 and about 4476 g/mol, a deposit whose systematic name carries only three of the four serines the registered subunit requires. GSRS then disagrees with its own subunit, its molecular formula property reading C210H328O69N46 against a calculated weight of 3790. The backbone is an oxyntomodulin analogue rather than a GLP-1 analogue (GSRS UNII MB76Z4IBZ5; PMID 41028652).

Eli Lilly originated the molecule as LY3305677 and licensed Chinese rights to Innovent Biologics, which is why the same compound appears in the literature under three codes. China's National Medical Products Administration approved it in June 2025 for long-term weight management in adults with a body-mass index of at least 28, or at least 24 with one or more weight-related comorbidity, and again in September 2025 for glycaemic control in adults with type 2 diabetes. Shirley's 2025 review in Drugs records both approvals and the proprietary name under which the product is marketed in China (PMID 41028652). A query of the FDA Drugs@FDA database by active ingredient returns no record for mazdutide.

That regulatory position is unusual for a compound of this class: approved and marketed in one jurisdiction, investigational everywhere else. A ClinicalTrials.gov v2 API query on query.term=mazdutide returned 38 registered studies on 18 August 2026; widening the term to mazdutide OR IBI362 OR LY3305677 returned 40, two of which register other molecules from the same two sponsors and were excluded by hand. Sponsorship splits cleanly along the licence. Innovent runs the Chinese registration programme under the IBI362 code, and Lilly runs the first-in-human work in the United Kingdom, a small phase 1 in Germany, a high-dose phase 1 and a phase 2 in the United States, and a completed phase 2 proof-of-concept study in alcohol use disorder. Anything described as a mazdutide result should be checked against which of those two programmes produced it, because they enrolled different populations.

Claim ledger

12 of 20 traced to a primary source
Reported figurePopulationRoutenSource
Body weight −14.01% at week 48 (6 mg) and −11.00% (4 mg) vs +0.30% placebo; ≥15% reduction reached by 49.5%, 35.7% and 2.0% respectivelyChinese adults, BMI ≥28 or 24 to <28 with a weight-related condition (GLORY-1)Subcutaneous, once weekly610 participantsJi 2025, N Engl J Med, PMID 40421736
Body weight −16.65% at week 60 (9 mg) vs −1.50% placebo, with 84.3% vs 33.1% reaching ≥5% reduction; vomiting 53.1% vs 1.3%, nausea 46.9% vs 3.2%, diarrhoea 39.4% vs 6.5%; discontinuation for adverse events 2.9% vs 0%Chinese adults with BMI ≥30, 16.1% with type 2 diabetes (GLORY-2)Subcutaneous, once weekly461 treated (307 mazdutide, 154 placebo)Gao 2026, JAMA, PMID 42251595
HbA1c −2.15% (6 mg) and −1.57% (4 mg) at week 24 vs −0.14% placebo; body weight −7.81% and −5.61% vs −1.26%Chinese adults with type 2 diabetes on diet and exercise alone, mean HbA1c 8.24%, mean BMI 28.2 (DREAMS-1)Subcutaneous, once weekly320 randomised 1:1:1Zhu 2026, Nature, PMID 41407859
HbA1c least-squares mean treatment difference vs dulaglutide 1.5 mg at week 28 of −0.24% (4 mg) and −0.30% (6 mg); body weight difference −3.78% and −5.76%Chinese adults with type 2 diabetes on background oral agents (DREAMS-2)Subcutaneous, once weekly731 randomised 1:1:1Guo 2026, Nature, PMID 41407860
Body weight −11.3% (6 mg), −10.4% (4.5 mg), −6.7% (3 mg) at week 24 vs +1.0% placeboChinese adults with overweight plus hyperphagia or a comorbidity, or obesity (phase 2, NCT04904913)Subcutaneous, once weekly248 randomised (62/63/61/62)Ji 2023, Nat Commun, PMID 38092790
HbA1c −1.41% to −1.67% at week 20 across mazdutide arms vs +0.03% placebo and −1.35% dulaglutide; body weight change up to −7.1% vs −1.4% and −2.7%Chinese adults with type 2 diabetes, HbA1c 7.0–10.5%, on diet and exercise or stable metforminSubcutaneous, once weekly250 randomised across five arms (51/49/49/50/51)Zhang 2024, Diabetes Care, PMID 37943529
HbA1c mean change from baseline to week 12 of −1.46% (3.0 mg), −2.23% (4.5 mg) and −1.66% (6.0 mg) vs −0.87% placebo and −1.98% dulaglutide 1.5 mg; only the 4.5 mg cohort reached a significant difference from placebo (−1.35%, 90% CI −2.30 to −0.41, P=0.0209)Chinese adults with type 2 diabetes, phase 1b (NCT04466904)Subcutaneous, once weekly, 12 weeks43 enrolled, 42 treated; 8 mazdutide, 4 placebo and 2 dulaglutide per cohortJiang 2022, Nat Commun, PMID 35750681
Body weight −11.7% at week 12 in the 9 mg cohort vs −1.8% placebo (estimated treatment difference −9.8%, 95% CI −14.4 to −5.3); −9.5% at week 16 in the 10 mg cohort vs −3.3%Chinese adults with overweight or obesity, multiple-ascending-dose phase 1bSubcutaneous, once weekly, dose escalated24 enrolled; 8 mazdutide and 4 placebo per cohortJi 2022, EClinicalMedicine, PMID 36247927
Terminal elimination half-life after the first dose ranged from 174.8 to 1075.7 hours (7.3 to 44.8 days); median Tmax approximately 72 hoursChinese adults with overweight or obesity, non-compartmental analysis after first doseSubcutaneous, single first dose within a multiple-dose regimen8 per dose cohortJi 2022, EClinicalMedicine, PMID 36247927
Mean change from baseline in heart rate up to +17.4 bpm (9 mg cohort) and +11.6 bpm (10 mg cohort) vs +4.3 bpm placebo; systolic blood pressure fell by up to 12 mm HgChinese adults with overweight or obesity, phase 1bSubcutaneous, once weekly8 mazdutide and 4 placebo per cohortJi 2022, EClinicalMedicine, PMID 36247927
Pulse rate increased by ≥10 bpm on two consecutive visits in 91.7% of mazdutide participants vs 37.5% of placebo; mean pulse 70→85 and 76→84 bpm by day 134 vs 72→64 on placebo; body weight −20.0% and −21.0% at week 20 vs −0.1%United States adults with overweight or obesity without diabetes, 16 mg target dose (NCT05623839)Subcutaneous, once weekly, two escalation regimens32 (24 mazdutide, 8 placebo)Bhattachar 2025, Diabetes Obes Metab, PMID 40832785
Body weight −18.1% at week 32 and −22.3% at week 48 (16 mg) vs −0.85% and −0.047% placebo; liver fat by MRI-PDFF −67.4% at week 48 (16 mg, n=31) vs −11.7% (placebo, n=36); treatment-emergent anti-drug antibodies in 11 of 51 at 16 mgUnited States adults with obesity or overweight, mean weight 107.6 kg; registry results posting, no journal publicationSubcutaneous, once weekly179 randomised (48/32/48/51)ClinicalTrials.gov NCT06124807 results, posted 21 April 2026
Mazdutide is a 39-amino-acid peptideThis descriptor appears across peptide overview pages and vendor product listings, sometimes alongside a printed sequence that contradicts it. The FDA GSRS record for UNII MB76Z4IBZ5 gives a single subunit of 34 residues, HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG, with Aib substituted at position 2, the Lys20 acylation and a C-terminal glycinamide. Counting the residues in the sequence that one such product page prints gives 34, matching GSRS exactly, while the same category of page describes the molecule as 39 residues in prose. Searched PubChem CID 167312357, the GSRS record and the four published phase 3 reports: no source gives 39. The figure appears to be carried over from retatrutide, a different triple agonist that does have 39 residues.No source found
Molecular formula C207H317N45O65, molecular weight approximately 4476 g/molThis pair is the PubChem record for CID 167312357 and is the figure most secondary pages repeat, but it does not describe the registered substance. The deposited IUPAC name, fetched from PUG-REST, contains three serine residues — two internal and one at the C-terminus — where the GSRS subunit HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG requires four and the GSRS systematic name ends GLYCYLGLYCYL-L-PROLYL-L-SERYL-L-SERYL-GLYCINAMIDE. Composing the registered structure by hand — 34 residues, Aib at position 2, C-terminal amide, and the AEEA-AEEA-gamma-Glu-C20-diacid on Lys20, minus four waters — gives C210H322N46O67 at 4563.14 g/mol, and the difference from the PubChem formula is exactly C3H5NO2, one serine residue. GSRS's own molecular formula property reads C210H328O69N46 with a calculated MOL_WEIGHT of 3790, agreeing on carbon and nitrogen and with neither figure on hydrogen and oxygen. Three registry sources, three answers; this page publishes the composed value and records the disagreement rather than averaging it.No source found
Mazdutide is also designated OXM-3Searched the GSRS name list for UNII MB76Z4IBZ5, which returns only mazdutide, IBI362, IBI-362, LY3305677, LY-3305677 and the two systematic names. Searched PubChem's synonym list for CID 167312357, which returns Mazdutide, 2259884-03-0, IBI362, GTPL13924, IBI-362, GLXC-26803, compound 1 [US9938335B2], EX-A12490, LY3305677 and LY-3305677. A PubChem name lookup on OXM-3 returns PUGREST.NotFound. General web search returns the designation only from chemical-supplier catalogue listings. It appears in no registry consulted, and it is not published as a synonym on this page.No source found
Mazdutide has a half-life of approximately seven daysThe only published pharmacokinetic report giving a half-life for this molecule is the 2022 phase 1b in EClinicalMedicine (PMID 36247927), which states a terminal elimination half-life after the first dose ranging from 174.8 to 1075.7 hours, or 7.3 to 44.8 days, in cohorts of eight. That is a six-fold spread, and the circulating single figure is its lower bound quoted as though it were a central estimate. Searched PubMed for mazdutide combined with half-life and with pharmacokinetics: zero records. DREAMS-1 and DREAMS-2 both list half-life as a secondary outcome on ClinicalTrials.gov, but neither has posted results and neither published paper reports it.No source found
Resting energy expenditure rose 8.3% at week 48, equivalent to roughly 120 to 150 additional kilocalories burned per dayThese figures appear on secondary review pages that present them as trial results. No published mazdutide trial measured energy expenditure. A search of the outcome measures of the registered mazdutide studies on ClinicalTrials.gov returned no trial listing resting energy expenditure, indirect calorimetry or any equivalent metabolic-rate endpoint; the only two matches on a body-composition keyword were investigator-initiated post-bariatric studies that have not begun reporting. The claim rests on the design rationale for glucagon receptor agonism rather than on a measurement in this compound.No source found
Mazdutide's activity is deliberately balanced between the two receptors in a stated potency ratioDescriptions of the molecule as GLP-1-weighted or glucagon-weighted circulate widely, occasionally with a numeric potency ratio attached. Numeric affinities do exist, but not in the journal literature: the IUPHAR/BPS Guide to Pharmacology, ligand 13924, records a human glucagon receptor Ki of 1.46x10^-8 M (pKi 7.8) and a human GLP-1 receptor Ki of 2.3x10^-8 M (pKi 7.6), both sourced to Eli Lilly patent US9938335B2 (Mezo, Chen, Valenzuela, Qu; priority 2016-06-16, published 2018-04-10), and both carrying an empty assay description, no assay conditions and no sample size. No peer-reviewed receptor-pharmacology paper for mazdutide is indexed in PubMed; searched mazdutide, IBI362 and LY3305677 across the PubMed record set, and no primary characterisation report is among them. The remaining in-vitro data cited by the 2022 phase 1b is conference abstract 682-P, Diabetes 2021, volume 70 supplement 1, which has no methods section. No published ratio traces to a described assay.No source found
Mazdutide preserves lean mass better than GLP-1 receptor monoagonistsSearched PubMed for mazdutide combined with body composition, lean mass, DXA and DEXA: three records returned, all of them reviews or meta-analyses, none a primary body-composition study. None of the four published phase 3 reports, the two phase 2 reports or the three phase 1 reports gives a fat-mass or fat-free-mass breakdown. Nong and colleagues report fat and lean mass changes for tirzepatide in their 2026 BMJ network meta-analysis but place mazdutide among emerging agents on weight loss alone at very low to low certainty. The comparison has no primary source.No source found
Mean body weight reduction of 15.7% at week 48 versus 2.1% with placebo, and 16.1% at week 52Both figures appear on aggregator pages that present them as phase 2b and phase 3 results. Neither matches any registered or published mazdutide trial. GLORY-1 reported −14.01% at week 48 against +0.30% on placebo; GLORY-2 reported −16.65% at week 60 against −1.50%. No mazdutide trial with a week-52 readout is registered on ClinicalTrials.gov. The same pages carry a discontinuation figure of 6.8% versus 2.1%, against the 0.5% to 1.5% versus 1.0% recorded in GLORY-1 and 2.9% versus 0% in GLORY-2. These are numbers with the shape of trial data and no trial behind them.No source found
On dosing. Vialog does not publish dosing protocols, titration schedules, or conversions to syringe units for any compound. Figures in the ledger above are the quantities administered in the studies cited, recorded so the origin of each number is visible. They are observations from published experiments, not instructions.

The glucagon half of the molecule

Oxyntomodulin is a proglucagon fragment that engages the GLP-1 receptor and the glucagon receptor together. Ji and colleagues frame the design of mazdutide against that biology in the introduction to their 2022 phase 1b report, citing the observation that glucagon receptor agonism raises energy expenditure and the observation that several earlier GLP-1 and glucagon dual agonists had not shown weight-loss superiority over GLP-1 receptor agonism alone. Adding glucagon receptor activity is the design premise of the molecule. It is not a demonstrated mechanism of any measured clinical outcome, and the published trials did not test it as one.

No peer-reviewed characterisation of mazdutide's receptor pharmacology appears in PubMed. The only retrievable numeric affinities sit outside the journal literature. The IUPHAR/BPS Guide to Pharmacology records, under ligand 13924, a human glucagon receptor Ki of 1.46x10^-8 M (pKi 7.8) and a human GLP-1 receptor Ki of 2.3x10^-8 M (pKi 7.6), both sourced to an Eli Lilly patent, US9938335B2, and both carrying an empty assay description. The in-vitro binding data and the mouse energy-expenditure data that the phase 1b report cites come from a 2021 American Diabetes Association conference abstract, number 682-P by Chen, Mezo, Coskun and colleagues, published in a Diabetes supplement, which likewise has no methods section. A PubMed search combining mazdutide with energy expenditure returns five records, of which four are narrative reviews and one is a multi-omics study in male db/db mice.

The consequence is a specific gap. The only retrievable numeric receptor-affinity values sit in a Lilly patent and a conference abstract, not in a peer-reviewed characterisation, and neither source publishes the assay that produced them. Statements about how mazdutide's activity is balanced between the two receptors, and statements about the size of any energy-expenditure effect, therefore cannot be checked against a described method. The preclinical file that does exist in PubMed is small and recent: a high-fat-diet mouse model of steatotic liver disease, the db/db cognition study, an MRI study of liver fat and iron in a diet-induced rodent model, and a 2026 Science Advances paper on tubular glucagon receptor signalling in which mazdutide appears in the framing rather than as the experimental agent.

The Chinese phase 3 programme

Four phase 3 trials have been published, all in Chinese adults, all sponsored by Innovent. GLORY-1 (NCT05607680) randomised 610 participants with a body-mass index of at least 28, or 24 to under 28 with a weight-related condition, to mazdutide 4 mg, mazdutide 6 mg or placebo for 48 weeks. Ji and colleagues reported in the New England Journal of Medicine in 2025 that mean percentage change in body weight at week 48 was −11.00% at 4 mg, −14.01% at 6 mg and +0.30% on placebo, with 35.7%, 49.5% and 2.0% of participants respectively reaching a reduction of at least 15%.

GLORY-2 (NCT06164873) tested a higher dose in a heavier population. Gao and colleagues reported in JAMA in 2026 that among 461 Chinese adults with a body-mass index of at least 30 who received treatment, mean percentage change in body weight at week 60 was −16.65% with 9 mg against −1.50% with placebo. The same trial recorded vomiting in 53.1% of the mazdutide group against 1.3% on placebo, nausea in 46.9% against 3.2%, and diarrhoea in 39.4% against 6.5%. Discontinuation attributable to adverse events was 2.9% against 0%.

Two diabetes trials appeared back to back in Nature in 2026. DREAMS-1 (NCT05628311) randomised 320 adults with type 2 diabetes controlled inadequately by diet and exercise alone; Zhu and colleagues reported HbA1c change at week 24 of −1.57% at 4 mg and −2.15% at 6 mg against −0.14% on placebo. DREAMS-2 (NCT05606913) randomised 731 participants already on background oral agents against dulaglutide 1.5 mg; Guo and colleagues reported least-squares mean treatment differences in HbA1c at week 28 of −0.24% and −0.30%, and in body weight of −3.78% and −5.76%.

Where the non-Chinese data lives

The largest non-Chinese trial to report is NCT06124807, a Lilly phase 2 conducted under a master protocol at United States sites, enrolling 179 adults with obesity or overweight, mean baseline weight 107.6 kg, 125 of them recorded as White and 34 as Black or African American. Results were posted to ClinicalTrials.gov in April 2026. No journal publication of the trial exists. Least-squares mean percentage change in body weight at week 32 was −7.33% in the 3/6 mg arm, −15.6% at 10 mg, −18.1% at 16 mg and −0.85% on placebo; at week 48 the corresponding figures were −10.54%, −19.2%, −22.3% and −0.047%.

The same posting carries findings that no mazdutide publication contains. Among participants with baseline liver fat of at least 5% measured by MRI proton density fat fraction, least-squares mean relative change at week 48 was −67.4% in the 16 mg arm against −11.7% on placebo, in 31 and 36 participants respectively. Treatment-emergent anti-drug antibodies were detected in 11 of 51 participants at 16 mg, 10 of 47 at 10 mg, 3 of 32 in the 3/6 mg arm and 5 of 47 on placebo. No deaths occurred; serious adverse events were reported in one to two participants per arm.

Earlier Lilly work is less accessible still. The first-in-human single-ascending-dose study (NCT02972645, 66 participants) and the multiple-ascending-dose study (NCT03325387, 56 participants) were both conducted in the United Kingdom and completed in 2017 and 2018; a 24-participant phase 1 in adults with type 2 diabetes ran in Germany (NCT03928379). None has posted results and none appears in PubMed under any of the three compound codes. The high-dose phase 1 in 32 United States adults did publish: Bhattachar and colleagues reported in Diabetes, Obesity and Metabolism in 2025, from NCT05623839, that mean percentage change in body weight at week 20 was −20.0% and −21.0% in the two 16 mg escalation cohorts against −0.1% on placebo.

Heart rate, and why it is measured

Both published phase 1 reports measured heart rate as a safety endpoint. In the 2022 multiple-ascending-dose phase 1b in Chinese adults with overweight or obesity, with eight participants receiving mazdutide and four receiving placebo in each cohort, mean change from baseline in heart rate reached 17.4 beats per minute in the 9 mg cohort and 11.6 in the 10 mg cohort, against 4.3 for pooled placebo (PMID 36247927). Ji and colleagues recorded ventricular extrasystoles in one mazdutide participant and one placebo participant, both mild, alongside a fall in systolic blood pressure of up to 12 mm Hg.

The high-dose phase 1 quantified it differently and more starkly. Bhattachar and colleagues reported mean pulse rate rising from 70 to 85 beats per minute in one cohort and 76 to 84 in the other by day 134, while the placebo group fell from 72 to 64. An increase of at least 10 beats per minute on two consecutive visits occurred in 91.7% of the 24 participants receiving mazdutide and 37.5% of the eight receiving placebo. No adverse electrocardiogram findings were recorded, and five participants had transient laboratory changes including raised transaminases.

No cardiovascular outcome trial for mazdutide is registered. Among the registered studies, one phase 4 trial of coronary plaque in 116 participants is listed as not yet recruiting with primary completion in October 2027, and a phase 2 study in heart failure with preserved or mildly reduced ejection fraction is recruiting. Whether the recorded heart rate change carries any clinical consequence over years of exposure is therefore an open question that the existing register is not designed to answer.

What the register holds that the literature does not

None of the four published Chinese phase 3 trials has posted results to ClinicalTrials.gov; they went to journals instead. That leaves the registry entries as protocol records only, so secondary endpoints not carried into the published abstracts cannot be checked against a posted results table. The reverse holds for the American phase 2, which posted results and has no paper. A reader tracing a mazdutide figure has to know which of the two conventions applies to the trial it came from.

Several completed trials have reported nothing anywhere. DREAMS-3 (NCT06184568), the first head-to-head comparison against semaglutide 1 mg in 349 Chinese adults with type 2 diabetes and obesity, completed in September 2025; Luo and colleagues published its design and baseline characteristics in Contemporary Clinical Trials in 2026, but no outcome data have appeared. The phase 2 proof-of-concept study in alcohol use disorder (NCT06817356), 308 participants at United States sites, reached primary completion in March 2026 with no results posted and no publication.

Citation hygiene in the secondary literature around this compound is uneven, including in peer-reviewed venues. The 2026 phase 2 report in Med on mazdutide 9 mg gives its registration as NCT01904913, which is not a valid ClinicalTrials.gov record; the trial it describes is NCT04904913. Kamrul-Hasan and colleagues, pooling nine randomised trials and 2292 participants in a 2026 meta-analysis, graded the certainty of the obesity weight-loss estimates as very low. Nong and colleagues, in a 262-trial network meta-analysis in the BMJ, placed mazdutide among emerging agents at 13.1% to 14.6% weight loss with very low to low certainty.

What is not known

Longest published exposure is 60 weeks, in GLORY-2. No durability, discontinuation-rebound or long-term safety data exist, and no cardiovascular outcome trial is registered, so whether the recorded heart rate increase matters over years is untested. Body composition has never been characterised, meaning the proportion of the recorded weight change attributable to fat mass against lean mass is unknown for this compound. Every published efficacy trial but one enrolled Chinese adults: the single published non-Chinese trial is a 32-participant phase 1, the larger United States phase 2 exists only as a ClinicalTrials.gov results posting, and the two United Kingdom first-in-human studies from 2017 and 2018 and a 24-participant phase 1 in Germany have neither posted results nor been published, so the foundational human pharmacokinetic and tolerability dataset is not publicly retrievable. The only retrievable receptor-affinity values sit in a patent and a conference abstract, neither of which publishes its assay. The registries do not agree on the molecular formula or the molecular weight. Nine registered trials in populations of specific interest — metabolic dysfunction-associated steatohepatitis, obstructive sleep apnoea, adolescents, heart failure with preserved ejection fraction, renal impairment, polycystic ovary syndrome, alcohol use disorder, hypertension, early dementia — are ongoing or completed without reporting. Published trials excluded people with type 1 diabetes and offer no data on pregnancy, lactation, or adults over 75. Mazdutide holds a marketing authorisation in China only; it is not approved by the FDA and no European authorisation was located. Material sold outside a registered trial or the Chinese supply chain has not been subject to the identity, purity or sterility controls that apply to either.

Questions

Is mazdutide FDA approved?
No. A query of the FDA Drugs@FDA database by active ingredient returns no record for mazdutide. It is approved in China, where the National Medical Products Administration authorised it in June 2025 for long-term weight management and in September 2025 for glycaemic control in type 2 diabetes. No European authorisation was located, and the European Medicines Agency register could not be queried directly, so that absence is recorded as a failed search rather than an established negative. Approval in one jurisdiction does not extend to others.
How many amino acids does mazdutide have?
Thirty-four. The FDA Global Substance Registration System record for UNII MB76Z4IBZ5 gives a single 34-residue subunit with 2-aminoisobutyric acid substituted at position 2, a C-terminal glycinamide, and the lysine at position 20 acylated by a C20 diacid through a gamma-glutamyl spacer and two AEEA linkers. The widely repeated figure of 39 residues appears to have been carried over from retatrutide, a different molecule. The PubChem deposit for this compound carries only 33 residues, one serine short of the registered subunit.
What is mazdutide's half-life?
The only published measurement is a range, not a figure. The 2022 phase 1b trial reported a terminal elimination half-life after the first dose of 174.8 to 1075.7 hours — 7.3 to 44.8 days — in cohorts of eight participants. Half-life is listed as a secondary outcome in both DREAMS phase 3 trials, but neither has posted results and neither publication reports it. Any single confident half-life figure for this compound is quoting the lower bound of that range.
Has mazdutide been tested outside China?
Yes. A ClinicalTrials.gov query run on 18 August 2026 returns seven registrations at non-Chinese sites. Two have reported: NCT05623839, a 32-participant high-dose phase 1 in the United States, published in 2025; and NCT06124807, a 179-participant phase 2 at United States sites whose results were posted in April 2026 with no journal article. Two first-in-human studies in the United Kingdom (NCT02972645, 66 participants; NCT03325387, 56), a 24-participant phase 1 in Germany (NCT03928379) and a completed 308-participant phase 2 in alcohol use disorder (NCT06817356) have posted nothing and published nothing. A Lilly master protocol (NCT06143956) is recruiting.
Are any of the cited papers retracted or under an expression of concern?
No. PubMed publication types and correction links were checked on every PMID cited on this page. None is typed as a Retracted Publication or carries an Expression of Concern, and none has an erratum attached. The only correction-type links present are comment links, and they resolve to correspondence rather than to corrections — a letter and the authors' reply published in the New England Journal of Medicine in September 2025 concerning GLORY-1, PMIDs 40929641 and 40929642, which were checked alongside the cited set.

References

  1. Ji L, Jiang H, Bi Y, et al. Once-Weekly Mazdutide in Chinese Adults with Obesity or Overweight (GLORY-1). N Engl J Med. 2025;392(22):2215–2225. PMID 40421736. View on doi.org
  2. Gao L, Jiang H, Cai H, et al. Treatment With 9-mg Mazdutide for Weight Reduction in Chinese Adults With Obesity: The GLORY-2 Randomized Clinical Trial. JAMA. 2026;336(5):377–388. PMID 42251595. View on doi.org
  3. Zhu D, Zhao J, Cai H, et al. Mazdutide versus placebo in Chinese adults with type 2 diabetes (DREAMS-1). Nature. 2026;652(8108):174–180. PMID 41407859. View on doi.org
  4. Guo L, Zhang B, Xue X, et al. Mazdutide versus dulaglutide in Chinese adults with type 2 diabetes (DREAMS-2). Nature. 2026;652(8108):181–188. PMID 41407860. View on doi.org
  5. Ji L, Jiang H, Cheng Z, et al. A phase 2 randomised controlled trial of mazdutide in Chinese overweight adults or adults with obesity. Nat Commun. 2023;14(1):8289. PMID 38092790. View on doi.org
  6. Zhang B, Cheng Z, Chen J, et al. Efficacy and Safety of Mazdutide in Chinese Patients With Type 2 Diabetes: A Randomized, Double-Blind, Placebo-Controlled Phase 2 Trial. Diabetes Care. 2024;47(1):160–168. PMID 37943529. View on doi.org
  7. Jiang H, Pang S, Zhang Y, et al. A phase 1b randomised controlled trial of a glucagon-like peptide-1 and glucagon receptor dual agonist IBI362 (LY3305677) in Chinese patients with type 2 diabetes. Nat Commun. 2022;13(1):3613. PMID 35750681. Registered as NCT04466904; 43 enrolled, 42 treated. View on doi.org
  8. Ji L, Gao L, Jiang H, et al. Safety and efficacy of a GLP-1 and glucagon receptor dual agonist mazdutide (IBI362) 9 mg and 10 mg in Chinese adults with overweight or obesity: a randomised, placebo-controlled, multiple-ascending-dose phase 1b trial. EClinicalMedicine. 2022;54:101691. PMID 36247927. Source of the only published half-life figures and the phase 1b heart rate data. View on doi.org
  9. Bhattachar SN, Tham LS, Li Y, et al. Mazdutide reduces body weight in adults with overweight or obesity: A high-dose Phase 1 trial. Diabetes Obes Metab. 2025;27(11):6460–6469. PMID 40832785. PubMed publication types: Randomized Controlled Trial; Clinical Trial, Phase I. Registered as NCT05623839, 32 participants at United States sites. View on doi.org
  10. Ji L, Jiang H, Cheng Z, et al. Mazdutide 9 mg in Chinese adults with a body mass index ≥30 kg/m2 but without diabetes: A phase 2 randomized controlled trial. Med. 2026;7(5):101063. PMID 41875890. Note: this paper gives its registration as NCT01904913, which is not a valid ClinicalTrials.gov record; the trial described is NCT04904913. View on doi.org
  11. Shirley M. Mazdutide: First Approval. Drugs. 2025;85(12):1621–1627. PMID 41028652. Records the June 2025 Chinese approval for weight management and the September 2025 approval for type 2 diabetes. View on doi.org
  12. Luo Y, Jiang H, Shi B, et al. Mazdutide versus Semaglutide for the treatment of type 2 diabetes and obesity: Rationale, design and baseline data of DREAMS-3 phase 3 trial. Contemp Clin Trials. 2026;160:108150. PMID 41260459. Design and baseline paper only; no outcome data published. View on doi.org
  13. Kamrul-Hasan ABM, Chatterjee S, Ashraf H, et al. Efficacy and Safety of the Dual Glucagon-Like Peptide-1 and Glucagon Receptor Agonist Mazdutide in Predominantly Chinese Adults With Obesity and/or Type 2 Diabetes: A Systematic Review and Meta-Analysis. Diabetes Obes Metab. 2026. PMID 42410325. Nine trials, 2292 participants; obesity weight-loss estimates graded very low certainty. View on doi.org
  14. Nong K, Shi Q, Xie X, et al. Comparative effects of drugs for adults with overweight or obesity: systematic review and network meta-analysis. BMJ. 2026;394:e372161. PMID 42419792. 262 trials, 99,791 participants; places mazdutide among emerging agents at 13.1–14.6% with very low to low certainty. View on doi.org
  15. IUPHAR/BPS Guide to PHARMACOLOGY, ligand 13924, mazdutide. Records human glucagon receptor Ki 1.46x10^-8 M (pKi 7.8) and human GLP-1 receptor Ki 2.3x10^-8 M (pKi 7.6), both sourced to Mezo AR, Chen Y, Valenzuela FA, Qu H. Glucagon and GLP-1 co-agonist compounds. US patent US9938335B2, Eli Lilly and Co, priority 16 June 2016, published 10 April 2018. Assay description and assay conditions are recorded as empty; no sample size is given. A patent is not a peer-reviewed report. View on www.guidetopharmacology.org
  16. FDA Global Substance Registration System. Mazdutide, UNII MB76Z4IBZ5. Substance record giving CAS 2259884-03-0, INN 12034, USAN JK-37, NCI Thesaurus C186406, the 34-residue subunit sequence and the Aib, Lys20 acyl and C-terminal glycinamide modifications; molecular formula property C210H328O69N46 and calculated MOL_WEIGHT 3790. View on gsrs.ncats.nih.gov
  17. PubChem Compound Summary CID 167312357, mazdutide. Molecular formula C207H317N45O65, molecular weight approximately 4476 g/mol, CAS 2259884-03-0, synonyms including IBI362, LY3305677, GTPL13924 and compound 1 [US9938335B2]. The deposited structure carries three of the four serines in the registered subunit. View on pubchem.ncbi.nlm.nih.gov
  18. ClinicalTrials.gov NCT06124807. A Phase 2, Parallel-Group, Double-Blind, 4-Arm Study to Investigate Weight Management With LY3305677 Compared With Placebo in Adult Participants With Obesity or Overweight. 179 participants at United States sites; results posted 21 April 2026; no journal publication. View on clinicaltrials.gov

Found an error? Report it. Corrections are logged publicly with a date; we do not silently edit pages.