Compound records · updated 27 Aug 2026
Tesamorelin
Tesamorelin is human growth hormone-releasing hormone, all forty-four residues, with an acyl group on the first and an amide on the last. It is one of the few compounds in this category holding an FDA approval, granted in 2010 for a single narrow indication. This page logs what the registration trials and the later academic trials measured, in which populations, and separates the figures that trace to a primary source from the ones that do not.
- Class
- Synthetic growth hormone-releasing hormone (GHRH/GRF) analogue; N-acylated hGRF(1-44) amide
- CAS number
- 218949-48-5 (free peptide); 901758-09-6 (acetate salt, UNII LGW5H38VE3)
- PubChem CID
- 16137828
- Molecular formula
- C221H366N72O67S (free peptide); drug substance is the acetate, C221H366N72O67S · x C2H4O2 with x ≈ 7
- Molecular weight
- 5136 g/mol (PubChem CID 16137828, average); 5135.9 Da (FDA labeling, free-base equivalent)
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL — human GHRH(1-44) with a (3E)-hex-3-enoyl group on Tyr1 and a C-terminal amide
- Also indexed as
- TH9507, TH-9507, (3E)-hex-3-enoylsomatoliberin (human); UNII MQG94M5EEO; INN 8786; USAN SS-04
Identity and regulatory status
Tesamorelin is human growth hormone-releasing hormone, all forty-four residues, carrying two modifications. A (3E)-hex-3-enoyl group sits on the tyrosine at position 1, and the C-terminal leucine is amidated. PubChem CID 16137828 records the formula C221H366N72O67S and an average mass near 5,136 g/mol. FDA labeling gives the same formula, identifies the drug substance as an acetate salt with approximately seven acetate equivalents, and states a free-base mass of 5,135.9 Da. The FDA Global Substance Registration System lists the free peptide under UNII MQG94M5EEO with CAS 218949-48-5, INN 8786 and USAN SS-04, and registers the acetate separately under UNII LGW5H38VE3 with CAS 901758-09-6.
Three CAS numbers circulate and each has a different referent. 218949-48-5 is the free peptide. 804475-66-9 resolves in PubChem to the same compound record, CID 16137828. 901758-09-6 returns a PUGREST.NotFound from a PubChem name query, which has led to its being treated as spurious, but the GSRS acetate record carries it, and the acetate is what the approved product contains. A fourth disagreement sits inside GSRS itself: the record displays a calculated formula of C221H365N71O69S at 5,040 Da, which does not reconcile with the amidated C-terminus described in that record's own structural notes. PubChem and the labeling agree with each other; the GSRS calculation agrees with neither.
Approval status is the unusual part of this record. Tesamorelin was approved by the FDA in 2010 for the reduction of excess abdominal fat in adults with HIV-associated lipodystrophy, and that remains the only approved indication. DailyMed currently carries two prescribing-information documents for the compound, both stamped with an initial US approval year of 2010, the newer describing a more concentrated 11.6 mg vial presentation. Approval covers one product, one indication and one population. It does not extend to material supplied outside that channel, which has not passed the identity, purity or sterility controls that apply to a licensed article. Growth hormone-releasing hormone analogues, tesamorelin among them named, are also prohibited in sport under the WADA code.
Claim ledger
12 of 19 traced to a primary source| Reported figure | Population | Route | n | Source |
|---|---|---|---|---|
| Visceral adipose tissue −15.2% vs +5.0% on placebo at 26 weeks (P<0.001); IGF-1 +81.0% vs −5.0% | Adults with HIV and abdominal fat accumulation on antiretroviral therapy, 86% male | Subcutaneous, 2 mg once daily | 412 randomised | Falutz 2007, N Engl J Med, PMID 18057338 |
| Pooled VAT treatment effect −15.4% at week 26 (−24 ± 41 cm² vs +2 ± 35 cm², P<0.001); IGF-1 +108 ± 112 vs −7 ± 64 ng/mL; no significant change in subcutaneous adipose tissue | Antiretroviral-treated adults with HIV and excess abdominal fat, pooled across two phase 3 trials | Subcutaneous, 2 mg once daily | 806 randomised | Falutz 2010, J Clin Endocrinol Metab, PMID 20554713 |
| VAT −10.9% (−21 cm²) vs −0.6% at 26 weeks (P<0.0001); approximately −18% at 52 weeks on continued treatment (P<0.001); the initial reduction was rapidly lost in those re-randomised from tesamorelin to placebo | Adults with HIV and abdominal fat accumulation; re-randomisation design at 6 months | Subcutaneous, 2 mg once daily | 404 randomised | Falutz 2010, J Acquir Immune Defic Syndr, PMID 20101189 |
| Hepatic fat fraction absolute effect −4.1 percentage points (95% CI −7.6 to −0.7, P=0.018), relative −37%; 35% vs 4% reached a fat fraction below 5% | Adults with HIV and hepatic fat fraction ≥5% | Subcutaneous, 2 mg once daily, 12 months | 61 (30 tesamorelin, 30 placebo) | Stanley 2019, Lancet HIV, PMID 31611038 |
| VAT −35 cm² vs placebo (95% CI −58 to −12, P=0.003); carotid intima-media thickness −0.04 mm (P=0.02); IGF-1 +92 µg/L (P<0.0001); no change in fasting glucose, 2-hour glucose or HbA1c | Abdominally obese adults without HIV, selected for reduced growth hormone secretion | Subcutaneous, 2 mg once daily, 12 months | 60 randomised | Makimura 2012, J Clin Endocrinol Metab, PMID 23015655 |
| Mean overnight GH +0.5 ± 0.1 µg/L (P=0.004), basal secretion +0.008 ± 0.003 µg/L·min (P=0.008), IGF-1 +181 ± 22 µg/L; insulin-stimulated glucose uptake unchanged (P=0.61) | Healthy men, mean age 45 ± 3, mean BMI 27.3 ± 1.2 | Subcutaneous, 2 mg once daily, 2 weeks | 13 | Stanley 2011, J Clin Endocrinol Metab, PMID 20943777 |
| Composite cognitive outcome favoured treatment at P=.03 (intention-to-treat) and P=.002 (completers); executive function P=.005, verbal memory P=.08; IGF-1 +117%; body fat −7.4%; fasting insulin +35% in the mild cognitive impairment group | Adults aged 55–87, 61 completers with mild cognitive impairment and 76 cognitively healthy | Subcutaneous, 1 mg once daily, 20 weeks | 152 enrolled, 137 completed | Baker 2012, Arch Neurol, PMID 22869065 |
| No significant between-group difference in neurocognitive change (P=0.673); within-arm change on tesamorelin 0.146 (95% CI −0.002 to 0.294, P=0.060); waist circumference median −2.7 cm (P=0.015) | Adults with HIV and abdominal obesity, randomised 3:2 against standard of care | Subcutaneous, 2 mg once daily, 6 months | 73 randomised | Ellis 2025, J Infect Dis, PMID 39813152 |
| Pooled VAT −27.71 cm² (95% CI −38.37 to −17.06); hepatic fat −4.28% (95% CI −6.31 to −2.24); trunk fat −1.18 kg; lean body mass +1.42 kg (95% CI 1.13 to 1.71) | Adults with HIV-associated lipodystrophy, meta-analysis of 5 randomised controlled trials | Subcutaneous (2 mg daily across included trials) | 5 RCTs pooled | Badran 2026, Obes Res Clin Pract, PMID 41545261 |
| Anti-tesamorelin IgG antibodies detected in 50% at 26 weeks and 47% at 52 weeks, and in 85% of the subset with hypersensitivity reactions; VAT and IGF-1 responses were similar with and without antibodies | Patients in the phase 3 programme | Subcutaneous, once daily | 543 treated, 263 placebo (26-week pool) | FDA prescribing information, EGRIFTA WR (tesamorelin), DailyMed SPL setid 839334d3-8c1d-4c26-9036-2ab524a6ea75, section 12.6 |
| HbA1c ≥6.5% from baseline to week 26 in 5% of treated vs 1% of placebo participants; hazard ratio for developing diabetes 3.3 (95% CI 1.4 to 9.6); IGF-1 SDS >2 in 47% and >3 in 36% at 26 weeks | Patients in the phase 3 programme | Subcutaneous, once daily | 543 treated, 263 placebo (26-week pool) | FDA prescribing information, EGRIFTA WR (tesamorelin), DailyMed SPL setid 839334d3-8c1d-4c26-9036-2ab524a6ea75, sections 5.2 and 5.4 |
| Elimination half-life 21 to 45 minutes; resistance to dipeptidyl aminopeptidase-IV deactivation and slowed in vitro degradation in rat, dog and human plasma; GH and IGF-1 markedly increased | Dogs (half-life); rats, dogs and pigs (GH/IGF-1 response); rat, dog and human plasma in vitro | Intravenous and subcutaneous, up to 600 µg/kg daily | Not stated per species in the abstract | Ferdinandi 2007, Basic Clin Pharmacol Toxicol, PMID 17214611 |
| Tesamorelin has a half-life of 26 to 38 minutes in humans | This pair of figures is repeated across aggregator and clinic pages, usually attributed to unnamed 'pharmacokinetic studies'. Neither number appears in either FDA prescribing-information document for the compound. One states a mean elimination half-life of 8 minutes in healthy subjects after a single subcutaneous dose; the other states 11 minutes. A PubMed search for tesamorelin population pharmacokinetics returned González-Sales 2015 (PMID 25358450), which fitted a one-compartment model across 38 subjects and reported clearance and volume but no terminal half-life. The nearest measured values in the 26–38 minute range are canine: 21 to 45 minutes in dogs (Ferdinandi 2007, PMID 17214611). No human measurement in that range was located. | No source found | ||
| Tesamorelin is approximately 40-fold more potent than sermorelin | A PubMed search combining tesamorelin with sermorelin, CJC-1295 or ipamorelin returned 15 records, every one a narrative review, a primer or a detection-methods paper. No randomised head-to-head comparison exists. A separate search for tesamorelin with EC50, half-maximal, affinity or GHRH receptor binding returned 6 records, again all reviews, with no primary receptor-pharmacology characterisation. The 40-fold figure could not be traced to any binding assay, functional assay or comparative trial. Ferdinandi 2007 (PMID 17214611) reports enhanced potency and duration of action relative to native hGRF(1-44)-NH2, which is a different comparison against a different molecule and carries no multiplier. | No source found | ||
| Tesamorelin does not desensitise the pituitary because the axis remains responsive to somatostatin | The observable half of this claim has partial support: Stanley 2011 (PMID 20943777) recorded increases in both basal and pulsatile growth hormone secretion in 13 healthy men over two weeks, and the phase 3 labeling shows IGF-1 elevations at 52 weeks in the same direction as at 26 weeks. The mechanistic half — that preserved somatostatin responsiveness is what prevents desensitisation — was not traceable. A PubMed search for tesamorelin with somatostatin, desensitisation or tachyphylaxis returned no study testing it. No trial has administered the compound continuously for longer than 52 weeks, so the durability of the secretory response beyond one year is untested rather than established. | No source found | ||
| Tesamorelin improves sleep quality or sleep-disordered breathing | Two trials were registered to test this and neither collected a single data point. NCT01788462, 'Egrifta Replacement and Sleep Disordered Breathing' at Johns Hopkins, is listed as withdrawn with an enrolment of 0. NCT02931474, a phase 2 study of GHRH for sleep in traumatic brain injury sponsored by NINR, is also listed as withdrawn with an enrolment of 0. A PubMed search returned no trial of tesamorelin with a sleep endpoint. The claim survives entirely on the trials that were planned, not on any that ran. | No source found | ||
| Tesamorelin builds lean mass in healthy trained adults | The lean-mass figure in circulation, an increase of 1.42 kg, is real but belongs to a different population: it is the pooled estimate from meta-analyses of randomised trials in adults with HIV-associated lipodystrophy (Badran 2026, PMID 41545261; Ditta 2026, PMID 42538058), a group characterised by reduced growth hormone secretion and altered fat distribution. Searching ClinicalTrials.gov across all 24 registered tesamorelin studies returned none enrolling healthy trained or athletic adults. The only healthy-volunteer study located, Stanley 2011, enrolled 13 men for two weeks and measured secretion and insulin sensitivity, not body composition. | No source found | ||
| Tesamorelin reduces visceral fat in adults with obesity generally | The one randomised trial outside HIV that reported a visceral fat endpoint, Makimura 2012 (PMID 23015655), required documented reduced growth hormone secretion as an entry criterion, as did its companion studies at the same centre. The second non-HIV trial, NCT03375788 in adults with obesity and hepatic steatosis, posted results to ClinicalTrials.gov in November 2025 — median liver fat change −5.3% in 18 analysed participants against +3.6% in 16 on placebo — but has not been published in the peer-reviewed literature, and PubMed returns no publication for it. No randomised trial has enrolled an unselected obesity population. | No source found | ||
| Molecular weight 5,040 Da, formula C221H365N71O69S | These values are displayed on the FDA GSRS record for UNII MQG94M5EEO as a calculated result. They do not reconcile with the C-terminal amidation and the (3E)-hex-3-enoyl substitution described in the structural notes of that same record. PubChem CID 16137828 gives C221H366N72O67S at approximately 5,136 g/mol, and both FDA prescribing-information documents give the identical formula with a free-base mass of 5,135.9 Da. Two independent regulatory and chemical sources agree; the GSRS automated calculation is the outlier and is recorded here as such rather than averaged in. | No source found | ||
What the registration trials measured
Two phase 3 trials carry the approval. Falutz and colleagues randomised 412 adults with HIV and abdominal fat accumulation on antiretroviral therapy, 86% male, to 2 mg subcutaneous tesamorelin daily or placebo for 26 weeks. Visceral adipose tissue measured by CT fell 15.2% in the treated arm and rose 5.0% on placebo (P<0.001). IGF-1 rose 81.0% against a 5.0% fall on placebo. Triglycerides fell 50 mg/dL against a 9 mg/dL rise, and the total cholesterol to HDL ratio fell 0.31 against a 0.21 rise. Glycaemic measures did not differ significantly between the groups at 26 weeks.
Pooling both phase 3 trials across 806 randomised participants, the same group reported a visceral adipose tissue treatment effect of −15.4% at week 26, with an absolute change of −24 ± 41 cm² on tesamorelin against +2 ± 35 cm² on placebo. Mean IGF-1 rose 108 ± 112 ng/mL against −7 ± 64. Subcutaneous adipose tissue showed no significant change in either arm, which is the finding that distinguishes this compound's measured effect from general fat loss: the change recorded was in the visceral compartment specifically, and total body weight was not the endpoint.
Both trials enrolled a population selected for a particular physiology — adults on long-term antiretroviral therapy with central fat accumulation, a group in which growth hormone secretion is characteristically reduced. That selection is the single most important qualifier on every figure above. The trials establish what happened in that population over 26 weeks. They do not establish what happens in anyone else, and the compound has never been tested against a general obesity population.
The 52-week extension and what withdrawal did
A second phase 3 trial, 404 participants, used a re-randomisation design that answers a question the 26-week readouts cannot. Participants received tesamorelin or placebo 2:1 for six months, at which point those on tesamorelin were re-randomised either to continue or to switch to placebo. At 26 weeks, visceral adipose tissue had fallen 10.9%, a reduction of 21 cm², against 0.6% in the placebo arm (P<0.0001). Among those who continued through twelve months, the reduction reached approximately 18% (P<0.001).
Among those switched to placebo at six months, the investigators recorded that the initial reduction was rapidly lost. That sentence is the durability finding for this compound, and it is the one most often left out of secondary summaries, which tend to quote the 18% figure without the arm that produced its counterpart. No published trial has measured what happens after any longer period of continuous administration; 52 weeks is the ceiling of the randomised record.
Outside HIV: two trials and a registry posting
Makimura and colleagues randomised 60 abdominally obese adults without HIV, selected for reduced growth hormone secretion, to 2 mg subcutaneous tesamorelin daily or placebo for twelve months. Visceral adipose tissue fell by 35 cm² relative to placebo (95% CI −58 to −12, P=0.003), carotid intima-media thickness by 0.04 mm (P=0.02), C-reactive protein by 0.15 mg/L (P=0.04) and triglycerides by 37 mg/dL (P=0.02). IGF-1 rose 92 µg/L (P<0.0001). No change was seen in fasting glucose, two-hour glucose or glycated haemoglobin. The entry criterion again required documented reduced growth hormone secretion.
Liver fat has been measured twice. In HIV-associated fatty liver disease, Stanley and colleagues randomised 61 participants with a hepatic fat fraction of at least 5% for twelve months and reported an absolute effect on hepatic fat fraction of −4.1 percentage points (95% CI −7.6 to −0.7, P=0.018), a relative reduction of 37%, with 35% of the treated arm and 4% of the placebo arm falling below a 5% fat fraction. Fasting glucose and glycated haemoglobin did not differ between groups at twelve months.
The equivalent trial without HIV exists but has not been published. NCT03375788, run at Massachusetts General Hospital, randomised adults aged 18 to 65 with a BMI of at least 30 and hepatic steatosis to 2 mg subcutaneous tesamorelin daily or placebo for twelve months. Results were posted to the registry in November 2025: median liver fat change of −5.3% (IQR −13.0 to −1.4) in 18 analysed participants against +3.6% (IQR −6.2 to +7.9) in 16 on placebo. A registry posting is not a peer-reviewed publication, and no such publication was located in PubMed at the time of writing.
The cognition record does not converge
Baker and colleagues randomised 152 adults aged 55 to 87, of whom 61 completers had mild cognitive impairment and 76 were cognitively healthy, to 1 mg subcutaneous tesamorelin daily or placebo for 20 weeks followed by a ten-week washout. A composite cognitive outcome favoured the treated arm at P=.03 in the intention-to-treat analysis and P=.002 among completers, with executive function at P=.005 and verbal memory at P=.08. IGF-1 rose 117% and body fat fell 7.4%. Fasting insulin rose 35% in the mild cognitive impairment group and did not change in the healthy adults.
Two subsequent trials did not reproduce that result. Ellis and colleagues randomised 73 adults with HIV and abdominal obesity 3:2 to 2 mg subcutaneous tesamorelin daily or standard of care for six months and reported no significant between-group difference in neurocognitive change (P=0.673), with a within-arm trend on tesamorelin that did not reach significance (mean change 0.146, 95% CI −0.002 to 0.294, P=0.060). Waist circumference fell by a median 2.7 cm (P=0.015). A 22-participant pilot at 1 mg daily for ten weeks, published in 2026, reported no significant change on its study measures.
Three trials, three different populations, three different doses and durations, and one positive composite outcome out of three. Any summary presenting the cognition literature as a settled finding is quoting the 2012 trial and omitting the two that followed it. Neither of the later trials was powered as a confirmatory replication, so the honest reading is that the question was raised in 2012 and has not since been answered in either direction.
Safety findings the trials recorded
Glucose is the signal the labeling treats most seriously. Elevated glycated haemoglobin at or above 6.5% was recorded from baseline to week 26 in 5% of treated participants against 1% on placebo, and the labeling reports a hazard ratio for developing diabetes of 3.3 (95% CI 1.4 to 9.6). This sits alongside the individual trials, several of which reported no significant between-group difference in glucose parameters at 26 or 52 weeks. Both statements come from the same programme. The trial-level comparisons were not powered for incident diabetes; the pooled hazard ratio is the figure that addresses it.
IGF-1 rises substantially and the labeling quantifies how far. At 26 weeks, 47% of treated patients had IGF-1 above 2 standard deviation scores and 36% above 3; at 52 weeks the corresponding figures were 34% and 23%. Anti-tesamorelin IgG antibodies were detected in 50% of patients treated for 26 weeks and 47% of those treated for 52 weeks, and in 85% of the subset who had hypersensitivity reactions. Visceral fat reduction and IGF-1 response were similar in patients with and without those antibodies.
Recorded adverse events in the 26-week phase 3 pool of 543 treated and 263 placebo participants were injection site reactions (17% against 6%), arthralgia (13% against 11%), myalgia and peripheral oedema (6% against 2% each) and pain in extremity (6% against 5%). Hypersensitivity reactions occurred in 4%. The labeling carries warnings on new malignancy, elevated IGF-1, fluid retention presenting as oedema, arthralgia and carpal tunnel syndrome, glucose intolerance, hypersensitivity and injection site reactions. The ten-year prospective cohort safety study that would have addressed the malignancy question, NCT01579695 with 391 participants, was terminated in 2018 with no results posted.
Pharmacokinetics, and the half-life that circulates
The approved labeling reports a mean elimination half-life of 8 minutes in healthy subjects after a single subcutaneous dose in one document, and 11 minutes in the other. Absolute subcutaneous bioavailability was determined to be less than 4%. Median time to peak concentration was 0.15 hours, mean peak concentration 2,956 pg/mL, and mean volume of distribution 4.8 ± 1.9 L/kg. A population pharmacokinetic analysis across 38 HIV-infected patients and healthy subjects fitted a one-compartment model with plasma clearance of 1,060 L/h and a volume of distribution of 200 L, and reported that the fraction absorbed by a first-order process was 13.1% higher on day 14 than on day 1.
Figures of 26 to 38 minutes appear widely and do not come from either labeling document. The nearest measured values in that range are canine: Ferdinandi and colleagues reported an elimination half-life of 21 to 45 minutes in dogs given the compound intravenously and subcutaneously at doses up to 600 µg/kg per day. That same non-clinical paper is the origin of the structural rationale repeated everywhere — that the hexenoyl group on Tyr1 confers resistance to dipeptidyl aminopeptidase-IV deactivation and slowed in vitro degradation in rat, dog and human plasma. The rationale is sourced. The human half-life figure attached to it is not.
Endogenous secretion has been characterised once directly. Stanley and colleagues gave 2 mg subcutaneously daily for two weeks to 13 healthy men of mean age 45 and reported an increase in mean overnight growth hormone of 0.5 ± 0.1 µg/L (P=0.004), in average log growth hormone peak area of 0.4 ± 0.1 (P=0.001) and in basal secretion of 0.008 ± 0.003 µg/L per minute (P=0.008), with IGF-1 up 181 ± 22 µg/L. Neither fasting glucose (P=0.93) nor insulin-stimulated glucose uptake (P=0.61) changed significantly. Thirteen men over two weeks is the whole of the direct human secretion-dynamics evidence.
What is not known
The randomised record stops at twelve months, and one trial showed the visceral fat reduction was rapidly lost when treatment was withdrawn at six months, so nothing is established about what happens after a year in either direction. The ten-year prospective cohort study designed to address the malignancy question, NCT01579695 with 391 participants, was terminated in 2018 and posted no results; the labeling's warning on new malignancy therefore rests on background risk reasoning rather than on completed long-term surveillance. Glucose sits unresolved: individual trials reported no significant between-group differences at 26 and 52 weeks, while the pooled labeling reports a hazard ratio of 3.3 for developing diabetes, and no trial was powered to settle that. The compound has never been tested in an unselected obesity population, in healthy young adults, in adolescents, or during pregnancy or lactation, and every trial outside HIV either required documented reduced growth hormone secretion at entry or remains unpublished. The cognition question raised in 2012 has not been answered by the two later trials, neither of which was designed as a replication. Half of treated patients developed anti-tesamorelin IgG antibodies, and while efficacy appeared unaffected over 52 weeks, the consequence of that response over longer exposure is unstudied. Physical behaviour in solution is separately undocumented and is covered elsewhere on this site.
Questions
Is tesamorelin FDA approved?
What is tesamorelin's half-life?
Do the visceral fat findings apply to people without HIV?
What happened when treatment stopped?
Why do sources disagree about tesamorelin's molecular weight?
References
- Falutz J, Allas S, Blot K, et al. Metabolic effects of a growth hormone-releasing factor in patients with HIV. N Engl J Med. 2007;357(23):2359-70. PubMed publication types checked: no retraction, expression of concern or erratum. PMID 18057338. View on doi.org
- Falutz J, Mamputu JC, Potvin D, et al. Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in HIV-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data. J Clin Endocrinol Metab. 2010;95(9):4291-304. No integrity flags on PubMed. PMID 20554713. View on doi.org
- Falutz J, Potvin D, Mamputu JC, et al. Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension. J Acquir Immune Defic Syndr. 2010;53(3):311-22. No integrity flags on PubMed. PMID 20101189. View on doi.org
- Stanley TL, Fourman LT, Feldpausch MN, et al. Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. Lancet HIV. 2019;6(12):e821-e830. No integrity flags on PubMed. PMID 31611038. View on doi.org
- Makimura H, Feldpausch MN, Rope AM, et al. Metabolic effects of a growth hormone-releasing factor in obese subjects with reduced growth hormone secretion: a randomized controlled trial. J Clin Endocrinol Metab. 2012;97(12):4769-79. No integrity flags on PubMed. PMID 23015655. View on doi.org
- Stanley TL, Chen CY, Branch KL, et al. Effects of a growth hormone-releasing hormone analog on endogenous GH pulsatility and insulin sensitivity in healthy men. J Clin Endocrinol Metab. 2011;96(1):150-8. No integrity flags on PubMed. PMID 20943777. View on doi.org
- Baker LD, Barsness SM, Borson S, et al. Effects of growth hormone-releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults: results of a controlled trial. Arch Neurol. 2012;69(11):1420-9. No integrity flags on PubMed. PMID 22869065. View on doi.org
- Ellis RJ, Vaida F, Hu K, et al. Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. J Infect Dis. 2025;231(5):1230-1238. No integrity flags on PubMed. PMID 39813152. View on doi.org
- Stewart CE, et al. The effect of growth hormone-releasing hormone on cognition and brain connectivity in adults with cognition ranging from normal to mild cognitive impairment. eNeurologicalSci. 2026;44:100616. Pilot trial, 22 participants, 1 mg daily for 10 weeks. PMID 42382101. View on pubmed.ncbi.nlm.nih.gov
- Badran AS, Helal A, Shata KS, Ayesh H. Body composition, hepatic fat, metabolic, and safety outcomes of Tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: A meta-analysis of randomized controlled trials. Obes Res Clin Pract. 2026;20(1):2-12. PMID 41545261. View on doi.org
- Ditta AM, Naeem RM, Sami MM, et al. Efficacy and Safety of Tesamorelin in People Living With HIV (PLWH) With Lipodystrophy: A Systematic Review and Meta-Analysis. J Int Assoc Provid AIDS Care. 2026;25:23259582261475549. Four randomised trials, 909 patients. PMID 42538058. View on doi.org
- Ferdinandi ES, Brazeau P, High K, et al. Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue. Basic Clin Pharmacol Toxicol. 2007;100(1):49-58. PMID 17214611. View on doi.org
- González-Sales M, Barès B, Tanguay M, et al. Population pharmacokinetic analysis of tesamorelin in HIV-infected patients and healthy subjects. Clin Pharmacokinet. 2015;54(3):285-94. PMID 25358450. View on doi.org
- Uçaktürk E, Nemutlu E. Analysis of growth hormone releasing hormone and its analogs in urine by nano-LC quadrupole/orbitrap mass spectrometry. J Pharm Biomed Anal. 2026. States that GHRH and its synthetic analogues are prohibited by the World Anti-Doping Agency. PMID 41138283. View on pubmed.ncbi.nlm.nih.gov
- Memdouh S, Gray B, Cowan DA, Parkin MC. Detection of the growth hormone releasing hormone analogues sermorelin, tesamorelin, CJC-1295 and CJC-1295 DAC in urine by LC-MS/MS. 2021. Opens by stating that administration of GHRH and its synthetic analogues is prohibited by WADA. PMID 34665524. View on pubmed.ncbi.nlm.nih.gov
- FDA prescribing information, EGRIFTA WR (tesamorelin) for injection. DailyMed SPL setid 839334d3-8c1d-4c26-9036-2ab524a6ea75. Source for the description, warnings, immunogenicity and pharmacokinetics figures on this page. View on dailymed.nlm.nih.gov
- FDA prescribing information, EGRIFTA SV (tesamorelin) for injection. DailyMed SPL setid 3d783378-b02d-4f19-99dd-0fc91a042224. Second labeling document, stating an 8-minute elimination half-life against the 11 minutes in the other. View on dailymed.nlm.nih.gov
- FDA Global Substance Registration System. Tesamorelin, UNII MQG94M5EEO (CAS 218949-48-5, INN 8786, USAN SS-04) and tesamorelin acetate, UNII LGW5H38VE3 (CAS 901758-09-6). View on gsrs.ncats.nih.gov
Found an error? Report it. Corrections are logged publicly with a date; we do not silently edit pages.